Lineage for d2cvlf1 (2cvl F:1-124)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727289Superfamily d.79.1: YjgF-like [55298] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 727290Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 727366Protein Putative translation intiation inhibitor TTHA0137 [143529] (1 species)
  7. 727367Species Thermus thermophilus [TaxId:274] [143530] (3 PDB entries)
  8. 727373Domain d2cvlf1: 2cvl F:1-124 [130876]
    automatically matched to 2CSL A:1-124

Details for d2cvlf1

PDB Entry: 2cvl (more details), 1.65 Å

PDB Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8
PDB Compounds: (F:) protein translation initiation inhibitor

SCOP Domain Sequences for d2cvlf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvlf1 d.79.1.1 (F:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]}
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae

SCOP Domain Coordinates for d2cvlf1:

Click to download the PDB-style file with coordinates for d2cvlf1.
(The format of our PDB-style files is described here.)

Timeline for d2cvlf1: