Lineage for d2cvlb_ (2cvl B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. Protein automated matches [190254] (5 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:274] [187040] (2 PDB entries)
  8. Domain d2cvlb_: 2cvl B: [130872]
    automated match to d1xrga_

Details for d2cvlb_

PDB Entry: 2cvl (more details), 1.65 Å

PDB Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8
PDB Compounds: (B:) protein translation initiation inhibitor

SCOPe Domain Sequences for d2cvlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvlb_ d.79.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae

SCOPe Domain Coordinates for d2cvlb_ are not available.

Timeline for d2cvlb_:

Domains from other chains:
(mouse over for more information)
d2cvla_, d2cvlc_, d2cvld_, d2cvle_, d2cvlf_