![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins) Swapped dimer with the "wing" C-terminal strands automatically mapped to Pfam PF13412 |
![]() | Protein Transcriptional regulator LrpC [140237] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [140238] (1 PDB entry) Uniprot P96582 1-63 |
![]() | Domain d2cfxa1: 2cfx A:1-63 [130395] Other proteins in same PDB: d2cfxa2, d2cfxb2, d2cfxc2, d2cfxd2, d2cfxe2, d2cfxf2, d2cfxg2, d2cfxh2 |
PDB Entry: 2cfx (more details), 2.4 Å
SCOPe Domain Sequences for d2cfxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk lgl
Timeline for d2cfxa1: