Lineage for d2cfxa1 (2cfx A:1-63)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins)
    Swapped dimer with the "wing" C-terminal strands
    automatically mapped to Pfam PF13412
  6. Protein Transcriptional regulator LrpC [140237] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [140238] (1 PDB entry)
    Uniprot P96582 1-63
  8. Domain d2cfxa1: 2cfx A:1-63 [130395]
    Other proteins in same PDB: d2cfxa2, d2cfxb2, d2cfxc2, d2cfxd2, d2cfxe2, d2cfxf2, d2cfxg2, d2cfxh2

Details for d2cfxa1

PDB Entry: 2cfx (more details), 2.4 Å

PDB Description: structure of b.subtilis lrpc
PDB Compounds: (A:) hth-type transcriptional regulator lrpc

SCOPe Domain Sequences for d2cfxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}
mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
lgl

SCOPe Domain Coordinates for d2cfxa1 are not available.

Timeline for d2cfxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cfxa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2cfxb1, d2cfxb2, d2cfxc1, d2cfxc2, d2cfxd1, d2cfxd2, d2cfxe1, d2cfxe2, d2cfxf1, d2cfxf2, d2cfxg1, d2cfxg2, d2cfxh1, d2cfxh2