Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins) Swapped dimer with the "wing" C-terminal strands automatically mapped to Pfam PF13412 |
Protein Transcriptional regulator LrpC [140237] (1 species) |
Species Bacillus subtilis [TaxId:1423] [140238] (1 PDB entry) Uniprot P96582 1-63 |
Domain d2cfxb1: 2cfx B:1-63 [130397] Other proteins in same PDB: d2cfxa2, d2cfxb2, d2cfxc2, d2cfxd2, d2cfxe2, d2cfxf2, d2cfxg2, d2cfxh2 automated match to d2cfxa1 |
PDB Entry: 2cfx (more details), 2.4 Å
SCOPe Domain Sequences for d2cfxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfxb1 a.4.5.32 (B:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk lgl
Timeline for d2cfxb1: