Lineage for d2cfxd2 (2cfx D:64-140)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949722Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
    octamer: tetramer of dimers
    automatically mapped to Pfam PF01037
  6. 2949751Protein Transcriptional regulator LrpC [143259] (1 species)
  7. 2949752Species Bacillus subtilis [TaxId:1423] [143260] (1 PDB entry)
    Uniprot P96582 64-140
  8. 2949756Domain d2cfxd2: 2cfx D:64-140 [130402]
    Other proteins in same PDB: d2cfxa1, d2cfxb1, d2cfxc1, d2cfxd1, d2cfxe1, d2cfxf1, d2cfxg1, d2cfxh1
    automated match to d2cfxa2

Details for d2cfxd2

PDB Entry: 2cfx (more details), 2.4 Å

PDB Description: structure of b.subtilis lrpc
PDB Compounds: (D:) hth-type transcriptional regulator lrpc

SCOPe Domain Sequences for d2cfxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfxd2 d.58.4.2 (D:64-140) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}
pvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfinkts
pyaqtvthvifseidtk

SCOPe Domain Coordinates for d2cfxd2:

Click to download the PDB-style file with coordinates for d2cfxd2.
(The format of our PDB-style files is described here.)

Timeline for d2cfxd2: