![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins) octamer: tetramer of dimers automatically mapped to Pfam PF01037 |
![]() | Protein Transcriptional regulator LrpC [143259] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [143260] (1 PDB entry) Uniprot P96582 64-140 |
![]() | Domain d2cfxh2: 2cfx H:64-140 [130410] Other proteins in same PDB: d2cfxa1, d2cfxb1, d2cfxc1, d2cfxd1, d2cfxe1, d2cfxf1, d2cfxg1, d2cfxh1 automated match to d2cfxa2 |
PDB Entry: 2cfx (more details), 2.4 Å
SCOPe Domain Sequences for d2cfxh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cfxh2 d.58.4.2 (H:64-140) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} pvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfinkts pyaqtvthvifseidtk
Timeline for d2cfxh2: