SCOPe 2.08: Domain d2caib2: 2cai B:3-84

Lineage for d2caib2 (2cai B:3-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225080] (4 PDB entries)

8. Domain d2caib2: 2cai B:3-84 [130158]
   Other proteins in same PDB: d2caia1, d2caib1
   automated match to d2f8fa2
   complexed with bme, pg4, so4; mutant

Details for d2caib2

PDB Entry: 2cai, 2.26 Å

PDB Description: structure of glutathione-s-transferase mutant, r21l, from schistosoma haematobium

PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2caib2:

Sequence; same for both SEQRES and ATOM records:

>d2caib2 c.47.1.0 (B:3-84) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
gdhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitdnh
ghvkwmveslaiarymakkhhm

Timeline for d2caib2:

• d2caib2 first appeared in SCOP 1.73
  
• d2caib2 appears in SCOPe 2.07