PDB entry 2cai

View 2cai on RCSB PDB site
Description: structure of glutathione-s-transferase mutant, r21l, from schistosoma haematobium
Class: transferase
Keywords: transferase, glutathione s-transferase, homodimer, thioredoxin-like fold, detoxification, antigen, multigene family
Deposited on 2005-12-21, released 2006-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase 28 kda
    Species: SCHISTOSOMA HAEMATOBIUM [TaxId:6185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30113 (Start-210)
      • engineered mutation (20)
    Domains in SCOPe 2.08: d2caia1, d2caia2
  • Chain 'B':
    Compound: glutathione s-transferase 28 kda
    Species: SCHISTOSOMA HAEMATOBIUM [TaxId:6185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30113 (Start-210)
      • engineered mutation (20)
    Domains in SCOPe 2.08: d2caib1, d2caib2
  • Heterogens: SO4, PG4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2caiA (A:)
    mtgdhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitd
    nhghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeek
    qkiikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltg
    kypeihkhrenllassprlakylsdraatpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2caiA (A:)
    dhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
    hvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeekqki
    ikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltgkyp
    eihkhrenllassprlakylsdraatpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2caiB (B:)
    mtgdhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitd
    nhghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeek
    qkiikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltg
    kypeihkhrenllassprlakylsdraatpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2caiB (B:)
    gdhikviyfngrgraesilmtlvaagvnyederisfqdwpkikptipggrlpavkitdnh
    ghvkwmveslaiarymakkhhmmggteeeyynvekligqaedleheyyktlmkpeeekqk
    iikeilngkvpvlldiiceslkastgklavgdkvtladlvliavidhvtdldkefltgky
    peihkhrenllassprlakylsdraatpf