SCOPe 2.08: Domain d2caib1: 2cai B:85-211

Lineage for d2caib1 (2cai B:85-211)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225081] (4 PDB entries)

8. Domain d2caib1: 2cai B:85-211 [130157]
   Other proteins in same PDB: d2caia2, d2caib2
   automated match to d2f8fa1
   complexed with bme, pg4, so4; mutant

Details for d2caib1

PDB Entry: 2cai, 2.26 Å

PDB Description: structure of glutathione-s-transferase mutant, r21l, from schistosoma haematobium

PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2caib1:

Sequence; same for both SEQRES and ATOM records:

>d2caib1 a.45.1.1 (B:85-211) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
draatpf

Timeline for d2caib1:

• d2caib1 first appeared in SCOP 1.73
  
• d2caib1 appears in SCOPe 2.07