![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225080] (4 PDB entries) |
![]() | Domain d2f8fa2: 2f8f A:4-84 [133123] Other proteins in same PDB: d2f8fa1, d2f8fb1 automated match to d1u3ia1 complexed with gsh; mutant |
PDB Entry: 2f8f (more details), 2.1 Å
SCOPe Domain Sequences for d2f8fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8fa2 c.47.1.0 (A:4-84) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} dhikviffngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg hvkwmveslaiarymakkhhm
Timeline for d2f8fa2: