SCOPe 2.08: Domain d2f8fb1: 2f8f B:85-205

Lineage for d2f8fb1 (2f8f B:85-205)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225081] (4 PDB entries)

8. Domain d2f8fb1: 2f8f B:85-205 [133124]
   Other proteins in same PDB: d2f8fa2, d2f8fb2
   automated match to d1u3ia2
   complexed with gsh; mutant

Details for d2f8fb1

PDB Entry: 2f8f, 2.1 Å

PDB Description: crystal structure of the y10f mutant of the gluathione s-transferase from schistosoma haematobium

PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2f8fb1:

Sequence; same for both SEQRES and ATOM records:

>d2f8fb1 a.45.1.1 (B:85-205) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
d

Timeline for d2f8fb1:

• d2f8fb1 first appeared in SCOP 1.73
  
• d2f8fb1 appears in SCOPe 2.07