Lineage for d1u3ia2 (1u3i A:85-211)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein automated matches [226848] (14 species)
not a true protein
Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [224992] (1 PDB entry) 
Domain d1u3ia2: 1u3i A:85-211 [202925]
Other proteins in same PDB: d1u3ia1
automated match to d2f8fa1
complexed with gsh
Details for d1u3ia2
PDB Entry: 1u3i (more details), 1.89 Å
PDB Description: crystal structure of glutathione s-tranferase from schistosoma mansoni
PDB Compounds: (A:) glutathione s-transferase 28 kdaSCOPe Domain Sequences for d1u3ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ia2 a.45.1.1 (A:85-211) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mgetdeeyysvekligqaedveheyhktlmkpqeekekitkeilngkvpvlfnmiceslk
gstgklavgdkvtladlvliavidhvtdldkgfltgkypeihkhrenllassprlakyls
nrpatpf
SCOPe Domain Coordinates for d1u3ia2:
Click to download the PDB-style file with coordinates for d1u3ia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u3ia2:
- d1u3ia2 first appeared in SCOPe 2.03
- d1u3ia2 appears in SCOPe 2.07
View in 3D
