| Class g: Small proteins [56992] (100 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Coagulation factor VIIa [57201] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
| Domain d2c4fl1: 2c4f L:46-82 [129806] Other proteins in same PDB: d2c4fh1, d2c4fl3, d2c4fu1 automatically matched to d1pfxl1 complexed with ca, fuc, gil, glc, nag |
PDB Entry: 2c4f (more details), 1.72 Å
SCOPe Domain Sequences for d2c4fl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4fl1 g.3.11.1 (L:46-82) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce
Timeline for d2c4fl1: