![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Coagulation factor VIIa [50550] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50551] (90 PDB entries) Uniprot P08709 213-466 ! Uniprot P08709 213-446 |
![]() | Domain d2c4fh1: 2c4f H:16-257 [129805] Other proteins in same PDB: d2c4fl1, d2c4fl2, d2c4fl3, d2c4fu1 automatically matched to d1cvwh_ complexed with ca, fuc, gil, glc, nag |
PDB Entry: 2c4f (more details), 1.72 Å
SCOPe Domain Sequences for d2c4fh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4fh1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d2c4fh1:
![]() Domains from other chains: (mouse over for more information) d2c4fl1, d2c4fl2, d2c4fl3, d2c4fu1 |