SCOPe 2.08: Domain d2c4fu1: 2c4f U:91-210

Lineage for d2c4fu1 (2c4f U:91-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d2c4fu1: 2c4f U:91-210 [145021]
   Other proteins in same PDB: d2c4fh1, d2c4fl1, d2c4fl2, d2c4fl3
   complexed with ca, fuc, gil, glc, nag

Details for d2c4fu1

PDB Entry: 2c4f, 1.72 Å

PDB Description: crystal structure of factor vii.stf complexed with pd0297121

PDB Compounds: (U:) tissue factor precursor

SCOPe Domain Sequences for d2c4fu1:

Sequence; same for both SEQRES and ATOM records:

>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
eplyenspeftpyletnlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkd
liytlyywsgkktaktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Timeline for d2c4fu1:

• d2c4fu1 first appeared in SCOP 1.75
  
• d2c4fu1 appears in SCOPe 2.07