![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries) |
![]() | Domain d2c3ma5: 2c3m A:669-785 [129744] Other proteins in same PDB: d2c3ma1, d2c3ma2, d2c3ma3, d2c3ma4, d2c3mb1, d2c3mb2, d2c3mb3, d2c3mb4 automated match to d1keka5 complexed with ca, cl, mg, sf4, tpp |
PDB Entry: 2c3m (more details), 1.84 Å
SCOPe Domain Sequences for d2c3ma5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3ma5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip
Timeline for d2c3ma5: