Lineage for d2c3mb4 (2c3m B:416-668)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892485Fold c.64: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53322] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 231456; strand 3 is antiparallel to the rest
  4. 2892486Superfamily c.64.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53323] (1 family) (S)
  5. 2892487Family c.64.1.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53324] (1 protein)
  6. 2892488Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53325] (1 species)
    also includes linker domain IV
  7. 2892489Species Desulfovibrio africanus [TaxId:873] [53326] (10 PDB entries)
  8. 2892493Domain d2c3mb4: 2c3m B:416-668 [129748]
    Other proteins in same PDB: d2c3ma1, d2c3ma2, d2c3ma3, d2c3ma5, d2c3mb1, d2c3mb2, d2c3mb3, d2c3mb5
    automated match to d1keka4
    complexed with ca, cl, mg, sf4, tpp

Details for d2c3mb4

PDB Entry: 2c3m (more details), 1.84 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c3mb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3mb4 c.64.1.1 (B:416-668) Pyruvate-ferredoxin oxidoreductase, PFOR, domain III {Desulfovibrio africanus [TaxId: 873]}
gtiqcqfwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpi
qstylvnradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtia
nkklkfynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkg
ekivkmntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklp
vsafeadgrfplg

SCOPe Domain Coordinates for d2c3mb4:

Click to download the PDB-style file with coordinates for d2c3mb4.
(The format of our PDB-style files is described here.)

Timeline for d2c3mb4: