Lineage for d1keka5 (1kek A:669-785)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949358Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 2949359Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries)
  8. 2949364Domain d1keka5: 1kek A:669-785 [68528]
    Other proteins in same PDB: d1keka1, d1keka2, d1keka3, d1keka4, d1kekb1, d1kekb2, d1kekb3, d1kekb4
    complexed with ca, co2, htl, mg, sf4

Details for d1keka5

PDB Entry: 1kek (more details), 1.9 Å

PDB Description: Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase
PDB Compounds: (A:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d1keka5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keka5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOPe Domain Coordinates for d1keka5:

Click to download the PDB-style file with coordinates for d1keka5.
(The format of our PDB-style files is described here.)

Timeline for d1keka5: