Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Leishmania major [TaxId:5664] [187010] (1 PDB entry) |
Domain d2c21e_: 2c21 E: [129653] Other proteins in same PDB: d2c21a1 automated match to d1f9za_ complexed with mpd, mrd, na, ni |
PDB Entry: 2c21 (more details), 2 Å
SCOPe Domain Sequences for d2c21e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c21e_ d.32.1.0 (E:) automated matches {Leishmania major [TaxId: 5664]} srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell nektmmekaeadmkeqgta
Timeline for d2c21e_: