Lineage for d2c21b_ (2c21 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942960Species Leishmania major [TaxId:5664] [187010] (1 PDB entry)
  8. 2942961Domain d2c21b_: 2c21 B: [129650]
    Other proteins in same PDB: d2c21a1
    automated match to d1f9za_
    complexed with mpd, mrd, na, ni

Details for d2c21b_

PDB Entry: 2c21 (more details), 2 Å

PDB Description: specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme
PDB Compounds: (B:) trypanothione-dependent glyoxalase I

SCOPe Domain Sequences for d2c21b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c21b_ d.32.1.0 (B:) automated matches {Leishmania major [TaxId: 5664]}
srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
nektmmekaeadmkeqgta

SCOPe Domain Coordinates for d2c21b_:

Click to download the PDB-style file with coordinates for d2c21b_.
(The format of our PDB-style files is described here.)

Timeline for d2c21b_: