SCOPe 2.07: Domain d2c21e_: 2c21 E:

Lineage for d2c21e_ (2c21 E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [187010] (1 PDB entry)

8. Domain d2c21e_: 2c21 E: [129653]
   Other proteins in same PDB: d2c21a1
   automated match to d1f9za_
   complexed with mpd, mrd, na, ni

Details for d2c21e_

PDB Entry: 2c21, 2 Å

PDB Description: specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme

PDB Compounds: (E:) trypanothione-dependent glyoxalase I

SCOPe Domain Sequences for d2c21e_:

Sequence; same for both SEQRES and ATOM records:

>d2c21e_ d.32.1.0 (E:) automated matches {Leishmania major [TaxId: 5664]}
srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
nektmmekaeadmkeqgta

Timeline for d2c21e_:

• d2c21e_ first appeared in SCOP 1.73, called d2c21e1
  
• d2c21e_ appears in SCOPe 2.06
  
• d2c21e_ appears in the current release, SCOPe 2.08