PDB entry 2c21

View 2c21 on RCSB PDB site
Description: specificity of the trypanothione-dependednt leishmania major glyoxalase I: structure and biochemical comparison with the human enzyme
Class: lyase
Keywords: glyoxalase I, lyase, leishmania major, trypanothione, glutathionylspermidine, methylglyoxal, detoxification
Deposited on 2005-09-23, released 2006-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypanothione-dependent glyoxalase I
    Species: LEISHMANIA MAJOR [TaxId:5664]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C21
    • Uniprot Q68RJ8 (Start-143)
    Domains in SCOPe 2.08: d2c21a1
  • Chain 'B':
    Compound: trypanothione-dependent glyoxalase I
    Species: LEISHMANIA MAJOR [TaxId:5664]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C21
    • Uniprot Q68RJ8 (Start-143)
    Domains in SCOPe 2.08: d2c21b_
  • Chain 'C':
    Compound: trypanothione-dependent glyoxalase I
    Species: LEISHMANIA MAJOR [TaxId:5664]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C21
    • Uniprot Q68RJ8 (Start-143)
    Domains in SCOPe 2.08: d2c21c_
  • Chain 'D':
    Compound: trypanothione-dependent glyoxalase I
    Species: LEISHMANIA MAJOR [TaxId:5664]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C21
    • Uniprot Q68RJ8 (Start-143)
    Domains in SCOPe 2.08: d2c21d_
  • Chain 'E':
    Compound: trypanothione-dependent glyoxalase I
    Species: LEISHMANIA MAJOR [TaxId:5664]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C21
    • Uniprot Q68RJ8 (Start-143)
    Domains in SCOPe 2.08: d2c21e_
  • Chain 'F':
    Compound: trypanothione-dependent glyoxalase I
    Species: LEISHMANIA MAJOR [TaxId:5664]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C21
    • Uniprot Q68RJ8 (Start-143)
    Domains in SCOPe 2.08: d2c21f_
  • Heterogens: NI, MPD, MRD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c21A (A:)
    gshmpsrrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstv
    leltynygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgy
    yiellnektmmekaeadmkeqgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c21A (A:)
    srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
    nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
    nektmmekaeadmkeqgta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c21B (B:)
    gshmpsrrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstv
    leltynygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgy
    yiellnektmmekaeadmkeqgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c21B (B:)
    srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
    nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
    nektmmekaeadmkeqgta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c21C (C:)
    gshmpsrrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstv
    leltynygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgy
    yiellnektmmekaeadmkeqgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c21C (C:)
    srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
    nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
    nektmmekaeadmkeqgta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c21D (D:)
    gshmpsrrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstv
    leltynygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgy
    yiellnektmmekaeadmkeqgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c21D (D:)
    srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
    nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
    nektmmekaeadmkeqgta
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c21E (E:)
    gshmpsrrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstv
    leltynygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgy
    yiellnektmmekaeadmkeqgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c21E (E:)
    srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
    nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
    nektmmekaeadmkeqgta
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c21F (F:)
    gshmpsrrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstv
    leltynygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgy
    yiellnektmmekaeadmkeqgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c21F (F:)
    srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
    nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
    nektmmekaeadmkeqgta