Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins) duplication: consists of two clear structural repeats each having this fold |
Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species) |
Species Leishmania major [TaxId:5664] [143126] (1 PDB entry) Uniprot Q68RJ8 3-141 Trypanothione-dependent glyoxalase i |
Domain d2c21a1: 2c21 A:3-141 [129649] Other proteins in same PDB: d2c21b_, d2c21c_, d2c21d_, d2c21e_, d2c21f_ complexed with mpd, mrd, na, ni |
PDB Entry: 2c21 (more details), 2 Å
SCOPe Domain Sequences for d2c21a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell nektmmekaeadmkeqgta
Timeline for d2c21a1: