Lineage for d2c21a1 (2c21 A:3-141)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942378Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
  6. 2942379Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)
  7. 2942406Species Leishmania major [TaxId:5664] [143126] (1 PDB entry)
    Uniprot Q68RJ8 3-141
    Trypanothione-dependent glyoxalase i
  8. 2942407Domain d2c21a1: 2c21 A:3-141 [129649]
    Other proteins in same PDB: d2c21b_, d2c21c_, d2c21d_, d2c21e_, d2c21f_
    complexed with mpd, mrd, na, ni

Details for d2c21a1

PDB Entry: 2c21 (more details), 2 Å

PDB Description: specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme
PDB Compounds: (A:) trypanothione-dependent glyoxalase I

SCOPe Domain Sequences for d2c21a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]}
srrmlhtmirvgdldrsikfyterlgmkvlrkwdvpedkytlvflgygpemsstvlelty
nygvtsykhdeayghiaigvedvkelvadmrkhdvpidyedesgfmafvvdpdgyyiell
nektmmekaeadmkeqgta

SCOPe Domain Coordinates for d2c21a1:

Click to download the PDB-style file with coordinates for d2c21a1.
(The format of our PDB-style files is described here.)

Timeline for d2c21a1: