SCOPe 2.02: Domain d2bkbb1: 2bkb B:201-282

Lineage for d2bkbb1 (2bkb B:201-282)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)

7. Species Escherichia coli [TaxId:562] [46614] (6 PDB entries)

8. Domain d2bkbb1: 2bkb B:201-282 [128669]
   Other proteins in same PDB: d2bkba2, d2bkbb2, d2bkbc2, d2bkbd2
   automatically matched to d1isaa1
   complexed with fe2

Details for d2bkbb1

PDB Entry: 2bkb, 1.7 Å

PDB Description: q69e-fesod

PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2bkbb1:

Sequence; same for both SEQRES and ATOM records:

>d2bkbb1 a.2.11.1 (B:201-282) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaaevwnhtfywnclap

Timeline for d2bkbb1:

• d2bkbb1 first appeared in SCOP 1.73
  
• d2bkbb1 appears in SCOPe 2.01
  
• d2bkbb1 appears in SCOPe 2.03
  
• d2bkbb1 appears in the current release, SCOPe 2.08