Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
Protein Fe superoxide dismutase (FeSOD) [46611] (10 species) |
Species Escherichia coli [TaxId:562] [46614] (6 PDB entries) |
Domain d2bkba1: 2bkb A:1-82 [128667] Other proteins in same PDB: d2bkba2, d2bkbb2, d2bkbc2, d2bkbd2 automatically matched to d1isaa1 complexed with fe2 |
PDB Entry: 2bkb (more details), 1.7 Å
SCOPe Domain Sequences for d2bkba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse ggvfnnaaevwnhtfywnclap
Timeline for d2bkba1: