Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
Species Escherichia coli [TaxId:562] [54727] (6 PDB entries) |
Domain d2bkbd2: 2bkb D:283-392 [128674] Other proteins in same PDB: d2bkba1, d2bkbb1, d2bkbc1, d2bkbd1 automatically matched to d1isaa2 complexed with fe2 |
PDB Entry: 2bkb (more details), 1.7 Å
SCOPe Domain Sequences for d2bkbd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkbd2 d.44.1.1 (D:283-392) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa
Timeline for d2bkbd2: