![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) ![]() |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
![]() | Protein Fe superoxide dismutase (FeSOD) [46611] (10 species) |
![]() | Species Escherichia coli [TaxId:562] [46614] (6 PDB entries) |
![]() | Domain d2bkbb1: 2bkb B:201-282 [128669] Other proteins in same PDB: d2bkba2, d2bkbb2, d2bkbc2, d2bkbd2 automatically matched to d1isaa1 complexed with fe2; mutant |
PDB Entry: 2bkb (more details), 1.7 Å
SCOP Domain Sequences for d2bkbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkbb1 a.2.11.1 (B:201-282) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse ggvfnnaaevwnhtfywnclap
Timeline for d2bkbb1: