| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle |
| Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
| Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [48673] (17 PDB entries) |
| Domain d2bcjg1: 2bcj G:8-67 [128290] Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjb1, d2bcjq1, d2bcjq2 automatically matched to d1omwg_ complexed with alf, gdp, mg |
PDB Entry: 2bcj (more details), 3.06 Å
SCOPe Domain Sequences for d2bcjg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcjg1 a.137.3.1 (G:8-67) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
Timeline for d2bcjg1: