Lineage for d2bcja2 (2bcj A:550-656)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957216Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 957296Protein G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) [50747] (2 species)
  7. 957297Species Cow (Bos taurus) [TaxId:9913] [89354] (3 PDB entries)
  8. 957299Domain d2bcja2: 2bcj A:550-656 [128287]
    Other proteins in same PDB: d2bcja1, d2bcja3, d2bcjb1, d2bcjg1, d2bcjq1, d2bcjq2
    automatically matched to d1omwa2
    complexed with alf, gdp, mg

Details for d2bcja2

PDB Entry: 2bcj (more details), 3.06 Å

PDB Description: crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits
PDB Compounds: (A:) g-protein coupled receptor kinase 2

SCOPe Domain Sequences for d2bcja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcja2 b.55.1.1 (A:550-656) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqq

SCOPe Domain Coordinates for d2bcja2:

Click to download the PDB-style file with coordinates for d2bcja2.
(The format of our PDB-style files is described here.)

Timeline for d2bcja2: