Lineage for d2bcjg1 (2bcj G:8-67)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099677Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1099771Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
  5. 1099772Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 1099773Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 1099774Species Cow (Bos taurus) [TaxId:9913] [48673] (18 PDB entries)
  8. 1099793Domain d2bcjg1: 2bcj G:8-67 [128290]
    Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjb1, d2bcjq1, d2bcjq2
    automatically matched to d1omwg_
    complexed with alf, gdp, mg

Details for d2bcjg1

PDB Entry: 2bcj (more details), 3.06 Å

PDB Description: crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits
PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit

SCOPe Domain Sequences for d2bcjg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcjg1 a.137.3.1 (G:8-67) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff

SCOPe Domain Coordinates for d2bcjg1:

Click to download the PDB-style file with coordinates for d2bcjg1.
(The format of our PDB-style files is described here.)

Timeline for d2bcjg1: