SCOPe 2.08: Domain d2b8ta1: 2b8t A:11-149

Lineage for d2b8ta1 (2b8t A:11-149)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
   N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)

6. Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species)

7. Species Ureaplasma urealyticum [TaxId:2130] [117561] (3 PDB entries)
   Uniprot Q9PPP5 11-211

8. Domain d2b8ta1: 2b8t A:11-149 [128109]
   Other proteins in same PDB: d2b8ta2, d2b8tb2, d2b8tc2, d2b8td2
   complexed with thm, trs, zn

Details for d2b8ta1

PDB Entry: 2b8t, 2 Å

PDB Description: crystal structure of thymidine kinase from u.urealyticum in complex with thymidine

PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d2b8ta1:

Sequence; same for both SEQRES and ATOM records:

>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidtrsirniqsrtgtslpsve
vesapeilnyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkg
epfgpiaklftyadkitkl

Timeline for d2b8ta1:

• d2b8ta1 first appeared in SCOP 1.73
  
• d2b8ta1 appears in SCOPe 2.07