![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein) C-terminal part of Pfam PF00265 |
![]() | Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species) |
![]() | Species Ureaplasma urealyticum [TaxId:2130] [118279] (3 PDB entries) Uniprot Q9PPP5 11-211 |
![]() | Domain d2b8td2: 2b8t D:150-219 [128116] Other proteins in same PDB: d2b8ta1, d2b8tb1, d2b8tc1, d2b8td1 automated match to d2b8ta2 complexed with thm, trs, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2b8t (more details), 2 Å
SCOPe Domain Sequences for d2b8td2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8td2 g.39.1.14 (D:150-219) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} taicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnsee fikffknkkr
Timeline for d2b8td2: