SCOPe 2.08: Domain d2b8tb2: 2b8t B:150-214

Lineage for d2b8tb2 (2b8t B:150-214)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein)
   C-terminal part of Pfam PF00265

6. Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species)

7. Species Ureaplasma urealyticum [TaxId:2130] [118279] (3 PDB entries)
   Uniprot Q9PPP5 11-211

8. Domain d2b8tb2: 2b8t B:150-214 [128112]
   Other proteins in same PDB: d2b8ta1, d2b8tb1, d2b8tc1, d2b8td1
   automated match to d2b8ta2
   complexed with thm, trs, zn
   has additional insertions and/or extensions that are not grouped together

Details for d2b8tb2

PDB Entry: 2b8t, 2 Å

PDB Description: crystal structure of thymidine kinase from u.urealyticum in complex with thymidine

PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d2b8tb2:

Sequence; same for both SEQRES and ATOM records:

>d2b8tb2 g.39.1.14 (B:150-214) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
taicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnsee
fikff

Timeline for d2b8tb2:

• d2b8tb2 first appeared in SCOP 1.73
  
• d2b8tb2 appears in SCOPe 2.07