![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Protein Fumarate reductase [46550] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [46551] (6 PDB entries) |
![]() | Domain d2b76n1: 2b76 N:106-243 [128019] Other proteins in same PDB: d2b76a1, d2b76a2, d2b76a3, d2b76b2, d2b76c1, d2b76d1, d2b76m1, d2b76m2, d2b76m3, d2b76n2, d2b76o1, d2b76p1 automatically matched to d1kf6b1 complexed with f3s, fad, fes, flc, mq7, sf4; mutant |
PDB Entry: 2b76 (more details), 3.3 Å
SCOPe Domain Sequences for d2b76n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b76n1 a.1.2.1 (N:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq qgkvesskdfliatlkpr
Timeline for d2b76n1: