![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54326] (6 PDB entries) |
![]() | Domain d2b76b2: 2b76 B:1-105 [128013] Other proteins in same PDB: d2b76a1, d2b76a2, d2b76a3, d2b76b1, d2b76c1, d2b76d1, d2b76m1, d2b76m2, d2b76m3, d2b76n1, d2b76o1, d2b76p1 automatically matched to d1kf6b2 complexed with f3s, fad, fes, flc, mq7, sf4; mutant |
PDB Entry: 2b76 (more details), 3.3 Å
SCOPe Domain Sequences for d2b76b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b76b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd
Timeline for d2b76b2: