![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Protein Fumarate reductase [46550] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [46551] (6 PDB entries) |
![]() | Domain d1kf6b1: 1kf6 B:106-243 [72397] Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b2, d1kf6c_, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n2, d1kf6o_, d1kf6p_ complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4 |
PDB Entry: 1kf6 (more details), 2.7 Å
SCOPe Domain Sequences for d1kf6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq qgkvesskdfliatlkpr
Timeline for d1kf6b1: