Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein Fumarate reductase subunit FrdC [81370] (2 species) |
Species Escherichia coli [TaxId:562] [81369] (5 PDB entries) is not known to bind heme |
Domain d2b76o1: 2b76 O:1-130 [128021] Other proteins in same PDB: d2b76a1, d2b76a2, d2b76a3, d2b76b1, d2b76b2, d2b76d1, d2b76m1, d2b76m2, d2b76m3, d2b76n1, d2b76n2, d2b76p1 automatically matched to d1kf6c_ complexed with f3s, fad, fes, flc, mq7, sf4; mutant |
PDB Entry: 2b76 (more details), 3.3 Å
SCOPe Domain Sequences for d2b76o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b76o1 f.21.2.2 (O:1-130) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]} ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat ivilfvalyw
Timeline for d2b76o1: