Lineage for d2b76d1 (2b76 D:0-118)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024622Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 3024642Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 3024660Protein Fumarate reductase subunit FrdD [81372] (2 species)
  7. 3024664Species Escherichia coli [TaxId:562] [81371] (6 PDB entries)
    is not known to bind heme
  8. 3024675Domain d2b76d1: 2b76 D:0-118 [128015]
    Other proteins in same PDB: d2b76a1, d2b76a2, d2b76a3, d2b76b1, d2b76b2, d2b76c1, d2b76m1, d2b76m2, d2b76m3, d2b76n1, d2b76n2, d2b76o1
    automatically matched to d1kf6d_
    complexed with f3s, fad, fes, flc, mq7, sf4; mutant

Details for d2b76d1

PDB Entry: 2b76 (more details), 3.3 Å

PDB Description: e. coli quinol fumarate reductase frda e49q mutation
PDB Compounds: (D:) Fumarate reductase subunit D

SCOPe Domain Sequences for d2b76d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b76d1 f.21.2.2 (D:0-118) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]}
minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti

SCOPe Domain Coordinates for d2b76d1:

Click to download the PDB-style file with coordinates for d2b76d1.
(The format of our PDB-style files is described here.)

Timeline for d2b76d1: