Lineage for d2b6bc1 (2b6b C:298-394)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765452Protein Envelope glycoprotein [49213] (5 species)
  7. 2765453Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 2765472Domain d2b6bc1: 2b6b C:298-394 [127980]
    Other proteins in same PDB: d2b6ba2, d2b6bb2, d2b6bc2, d2b6bd1
    automatically matched to d1tg8a1

Details for d2b6bc1

PDB Entry: 2b6b (more details)

PDB Description: cryo em structure of dengue complexed with crd of dc-sign
PDB Compounds: (C:) Envelope glycoprotein

SCOPe Domain Sequences for d2b6bc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b6bc1 b.1.18.4 (C:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOPe Domain Coordinates for d2b6bc1:

Click to download the PDB-style file with coordinates for d2b6bc1.
(The format of our PDB-style files is described here.)

Timeline for d2b6bc1: