PDB entry 2b6b

View 2b6b on RCSB PDB site
Description: Cryo EM structure of Dengue complexed with CRD of DC-SIGN
Class: Virus/Receptor
Keywords: Cryo EM dengue CRD DC-SIGN, Icosahedral virus, Virus-Receptor COMPLEX
Deposited on 2005-09-30, released 2006-03-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: EM
Resolution: 25 Å
R-factor: N/A
AEROSPACI score: -0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein
    Species: Dengue virus [TaxId:12637]
    Database cross-references and differences (RAF-indexed):
    • GB AAA17504 (0-393)
      • conflict (70)
      • conflict (389)
    Domains in SCOPe 2.06: d2b6ba1, d2b6ba2
  • Chain 'B':
    Compound: Envelope glycoprotein
    Species: Dengue virus [TaxId:12637]
    Database cross-references and differences (RAF-indexed):
    • GB AAA17504 (0-393)
      • conflict (70)
      • conflict (389)
    Domains in SCOPe 2.06: d2b6bb1, d2b6bb2
  • Chain 'C':
    Compound: Envelope glycoprotein
    Species: Dengue virus [TaxId:12637]
    Database cross-references and differences (RAF-indexed):
    • GB AAA17504 (0-393)
      • conflict (70)
      • conflict (389)
    Domains in SCOPe 2.06: d2b6bc1, d2b6bc2
  • Chain 'D':
    Compound: CD209 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b6bd1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b6bA (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6bA (A:)
    mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
    akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
    knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
    mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b6bB (B:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6bB (B:)
    mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
    akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
    knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
    mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b6bC (C:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6bC (C:)
    mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
    akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
    knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
    mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b6bD (D:)
    mgsshhhhhhssglvprgshmrlchpcpwewtffqgncyfmsnsqrnwhdsitackevga
    qlvviksaeeqnflqlqssrsnrftwmglsdlnqegtwqwvdgspllpsfkqywnrgepn
    nvgeedcaefsgngwnddkcnlakfwickksaascsrdeeqflspapatpnpppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6bD (D:)
    pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft
    wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf
    wickksaa