![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
![]() | Protein Envelope glycoprotein [56985] (2 species) |
![]() | Species Dengue virus type 2 [TaxId:11060] [90131] (8 PDB entries) Uniprot P12823 281-675 |
![]() | Domain d2b6bb2: 2b6b B:1-297 [127979] Other proteins in same PDB: d2b6ba1, d2b6bb1, d2b6bc1, d2b6bd1 automatically matched to d1tg8a2 |
PDB Entry: 2b6b (more details)
SCOPe Domain Sequences for d2b6bb2:
Sequence, based on SEQRES records: (download)
>d2b6bb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]} mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
>d2b6bb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]} mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d2b6bb2: