Lineage for d2b6bd1 (2b6b D:255-382)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001374Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)
  7. 3001375Species Human (Homo sapiens) [TaxId:9606] [69856] (7 PDB entries)
    Uniprot Q9NNX6 253-384
  8. 3001396Domain d2b6bd1: 2b6b D:255-382 [127982]
    Other proteins in same PDB: d2b6ba1, d2b6ba2, d2b6bb1, d2b6bb2, d2b6bc1, d2b6bc2
    automatically matched to d1k9id_

Details for d2b6bd1

PDB Entry: 2b6b (more details)

PDB Description: cryo em structure of dengue complexed with crd of dc-sign
PDB Compounds: (D:) CD209 antigen

SCOPe Domain Sequences for d2b6bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b6bd1 d.169.1.1 (D:255-382) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens) [TaxId: 9606]}
pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft
wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf
wickksaa

SCOPe Domain Coordinates for d2b6bd1:

Click to download the PDB-style file with coordinates for d2b6bd1.
(The format of our PDB-style files is described here.)

Timeline for d2b6bd1: