Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family) |
Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein) |
Protein Colicin E3 receptor domain [69987] (1 species) |
Species Escherichia coli [TaxId:562] [69988] (4 PDB entries) |
Domain d2b5uc3: 2b5u C:316-454 [127912] Other proteins in same PDB: d2b5ua1, d2b5ua2, d2b5ub_, d2b5uc1, d2b5uc2, d2b5ud_ automatically matched to d1jcha3 complexed with cit; mutant |
PDB Entry: 2b5u (more details), 2.3 Å
SCOPe Domain Sequences for d2b5uc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5uc3 h.4.9.1 (C:316-454) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]} veaaernyeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqf nrfahdpmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkk edkkrsaennlndeknkpr
Timeline for d2b5uc3: