Lineage for d2b5uc2 (2b5u C:84-315)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821142Fold b.110: Cloacin translocation domain [69368] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 2821143Superfamily b.110.1: Cloacin translocation domain [69369] (1 family) (S)
    automatically mapped to Pfam PF03515
  5. 2821144Family b.110.1.1: Cloacin translocation domain [69370] (2 proteins)
    Pfam PF03515
  6. 2821148Protein Colicin E3 N-terminal domain [69371] (1 species)
  7. 2821149Species Escherichia coli [TaxId:562] [69372] (2 PDB entries)
  8. 2821151Domain d2b5uc2: 2b5u C:84-315 [127911]
    Other proteins in same PDB: d2b5ua1, d2b5ua3, d2b5ub_, d2b5uc1, d2b5uc3, d2b5ud_
    automatically matched to d1jcha2
    complexed with cit; mutant

Details for d2b5uc2

PDB Entry: 2b5u (more details), 2.3 Å

PDB Description: crystal structure of colicin e3 v206c mutant in complex with its immunity protein
PDB Compounds: (C:) Colicin E3

SCOPe Domain Sequences for d2b5uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5uc2 b.110.1.1 (C:84-315) Colicin E3 N-terminal domain {Escherichia coli [TaxId: 562]}
vaapvafgfpalstpgagglavsisagalsaaiadimaalkgpfkfglwgvalygvlpsq
iakddpnmmskivtslpadditespvsslpldkatvnvnvrvvddvkderqnisvvsgvp
mscpvvdakpterpgvftasipgapvlnisvnnstpavqtlspgvtnntdkdvrpagftq
ggntrdavirfpkdsghnavyvsvsdvlspdqvkqrqdeenrrqqewdathp

SCOPe Domain Coordinates for d2b5uc2:

Click to download the PDB-style file with coordinates for d2b5uc2.
(The format of our PDB-style files is described here.)

Timeline for d2b5uc2: