PDB entry 2b5u

View 2b5u on RCSB PDB site
Description: Crystal Structure Of Colicin E3 V206C Mutant In Complex With Its Immunity Protein
Class: ribosome inhibitor, hydrolase
Keywords: High resolution crystal structure, Colicin E3, Immunity Protein, Ribosome inactivation, RIBOSOME INHIBITOR, HYDROLASE
Deposited on 2005-09-29, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Colicin E3
    Species: Escherichia coli [TaxId:562]
    Gene: ceaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00646 (Start-550)
      • engineered (205)
    Domains in SCOPe 2.07: d2b5ua1, d2b5ua2, d2b5ua3
  • Chain 'B':
    Compound: Colicin E3 immunity protein
    Species: Escherichia coli [TaxId:562]
    Gene: imm, ceiC, immB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b5ub_
  • Chain 'C':
    Compound: Colicin E3
    Species: Escherichia coli [TaxId:562]
    Gene: ceaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00646 (Start-550)
      • engineered (205)
    Domains in SCOPe 2.07: d2b5uc1, d2b5uc2, d2b5uc3
  • Chain 'D':
    Compound: Colicin E3 immunity protein
    Species: Escherichia coli [TaxId:562]
    Gene: imm, ceiC, immB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b5ud_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b5uA (A:)
    msggdgrghntgahstsgninggptglgvgggasdgsgwssennpwgggsgsgihwgggs
    ghgngggngnsgggsgtggnlsavaapvafgfpalstpgagglavsisagalsaaiadim
    aalkgpfkfglwgvalygvlpsqiakddpnmmskivtslpadditespvsslpldkatvn
    vnvrvvddvkderqnisvvsgvpmscpvvdakpterpgvftasipgapvlnisvnnstpa
    vqtlspgvtnntdkdvrpagftqggntrdavirfpkdsghnavyvsvsdvlspdqvkqrq
    deenrrqqewdathpveaaernyeraraelnqanedvarnqerqakavqvynsrkselda
    anktladaiaeikqfnrfahdpmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksd
    adaalssamesrkkkedkkrsaennlndeknkprkgfkdyghdyhpapktenikglgdlk
    pgipktpkqngggkrkrwtgdkgrkiyewdsqhgelegyrasdgqhlgsfdpktgnqlkg
    pdpkrnikkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5uA (A:)
    savaapvafgfpalstpgagglavsisagalsaaiadimaalkgpfkfglwgvalygvlp
    sqiakddpnmmskivtslpadditespvsslpldkatvnvnvrvvddvkderqnisvvsg
    vpmscpvvdakpterpgvftasipgapvlnisvnnstpavqtlspgvtnntdkdvrpagf
    tqggntrdavirfpkdsghnavyvsvsdvlspdqvkqrqdeenrrqqewdathpveaaer
    nyeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqfnrfahd
    pmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkkedkkrs
    aennlndeknkprkgfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgd
    kgrkiyewdsqhgelegyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b5uB (B:)
    glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
    yfnhqidisdneyfvsfdyrdgdw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b5uC (C:)
    msggdgrghntgahstsgninggptglgvgggasdgsgwssennpwgggsgsgihwgggs
    ghgngggngnsgggsgtggnlsavaapvafgfpalstpgagglavsisagalsaaiadim
    aalkgpfkfglwgvalygvlpsqiakddpnmmskivtslpadditespvsslpldkatvn
    vnvrvvddvkderqnisvvsgvpmscpvvdakpterpgvftasipgapvlnisvnnstpa
    vqtlspgvtnntdkdvrpagftqggntrdavirfpkdsghnavyvsvsdvlspdqvkqrq
    deenrrqqewdathpveaaernyeraraelnqanedvarnqerqakavqvynsrkselda
    anktladaiaeikqfnrfahdpmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksd
    adaalssamesrkkkedkkrsaennlndeknkprkgfkdyghdyhpapktenikglgdlk
    pgipktpkqngggkrkrwtgdkgrkiyewdsqhgelegyrasdgqhlgsfdpktgnqlkg
    pdpkrnikkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5uC (C:)
    savaapvafgfpalstpgagglavsisagalsaaiadimaalkgpfkfglwgvalygvlp
    sqiakddpnmmskivtslpadditespvsslpldkatvnvnvrvvddvkderqnisvvsg
    vpmscpvvdakpterpgvftasipgapvlnisvnnstpavqtlspgvtnntdkdvrpagf
    tqggntrdavirfpkdsghnavyvsvsdvlspdqvkqrqdeenrrqqewdathpveaaer
    nyeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqfnrfahd
    pmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkkedkkrs
    aennlndeknkprkgfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgd
    kgrkiyewdsqhgelegyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b5uD (D:)
    glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
    yfnhqidisdneyfvsfdyrdgdw