![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.2: Colicin E3 immunity protein [54552] (1 family) ![]() automatically mapped to Pfam PF03513 |
![]() | Family d.26.2.1: Colicin E3 immunity protein [54553] (1 protein) |
![]() | Protein Colicin E3 immunity protein [54554] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [54555] (4 PDB entries) |
![]() | Domain d2b5ub_: 2b5u B: [127909] Other proteins in same PDB: d2b5ua1, d2b5ua2, d2b5ua3, d2b5uc1, d2b5uc2, d2b5uc3 automated match to d1e44a_ complexed with cit; mutant |
PDB Entry: 2b5u (more details), 2.3 Å
SCOPe Domain Sequences for d2b5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5ub_ d.26.2.1 (B:) Colicin E3 immunity protein {Escherichia coli [TaxId: 562]} glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp yfnhqidisdneyfvsfdyrdgdw
Timeline for d2b5ub_: