Lineage for d2b5ua2 (2b5u A:84-315)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075111Fold b.110: Cloacin translocation domain [69368] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 2075112Superfamily b.110.1: Cloacin translocation domain [69369] (1 family) (S)
    automatically mapped to Pfam PF03515
  5. 2075113Family b.110.1.1: Cloacin translocation domain [69370] (2 protein domains)
    Pfam PF03515
  6. 2075117Protein Colicin E3 N-terminal domain [69371] (1 species)
  7. 2075118Species Escherichia coli [TaxId:562] [69372] (2 PDB entries)
  8. 2075119Domain d2b5ua2: 2b5u A:84-315 [127907]
    Other proteins in same PDB: d2b5ua1, d2b5ua3, d2b5ub_, d2b5uc1, d2b5uc3, d2b5ud_
    automatically matched to d1jcha2
    complexed with cit; mutant

Details for d2b5ua2

PDB Entry: 2b5u (more details), 2.3 Å

PDB Description: crystal structure of colicin e3 v206c mutant in complex with its immunity protein
PDB Compounds: (A:) Colicin E3

SCOPe Domain Sequences for d2b5ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ua2 b.110.1.1 (A:84-315) Colicin E3 N-terminal domain {Escherichia coli [TaxId: 562]}
vaapvafgfpalstpgagglavsisagalsaaiadimaalkgpfkfglwgvalygvlpsq
iakddpnmmskivtslpadditespvsslpldkatvnvnvrvvddvkderqnisvvsgvp
mscpvvdakpterpgvftasipgapvlnisvnnstpavqtlspgvtnntdkdvrpagftq
ggntrdavirfpkdsghnavyvsvsdvlspdqvkqrqdeenrrqqewdathp

SCOPe Domain Coordinates for d2b5ua2:

Click to download the PDB-style file with coordinates for d2b5ua2.
(The format of our PDB-style files is described here.)

Timeline for d2b5ua2: