Lineage for d2azec1 (2aze C:829-872)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047516Fold j.119: Retinoblastoma-associated protein RB1 fragments [144325] (1 superfamily)
  4. 3047517Superfamily j.119.1: Retinoblastoma-associated protein RB1 fragments [144326] (1 family) (S)
  5. 3047518Family j.119.1.1: Retinoblastoma-associated protein RB1 fragments [144327] (1 protein)
  6. 3047519Protein Retinoblastoma-associated protein RB1 fragments [144328] (1 species)
  7. 3047520Species Human (Homo sapiens) [TaxId:9606] [144329] (1 PDB entry)
    Uniprot P06400 829-872
  8. 3047521Domain d2azec1: 2aze C:829-872 [127607]
    Other proteins in same PDB: d2azea1, d2azea2, d2azeb1
    near C-terminal fragment bound to the E2F1-DP1 heterodimer

Details for d2azec1

PDB Entry: 2aze (more details), 2.55 Å

PDB Description: Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer
PDB Compounds: (C:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d2azec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azec1 j.119.1.1 (C:829-872) Retinoblastoma-associated protein RB1 fragments {Human (Homo sapiens) [TaxId: 9606]}
srilvsigesfgtsekfqkinqmvcnsdrvlkrsaegsnppkpl

SCOPe Domain Coordinates for d2azec1:

Click to download the PDB-style file with coordinates for d2azec1.
(The format of our PDB-style files is described here.)

Timeline for d2azec1: