| Class j: Peptides [58231] (151 folds) |
| Fold j.119: Retinoblastoma-associated protein RB1 fragments [144325] (1 superfamily) |
Superfamily j.119.1: Retinoblastoma-associated protein RB1 fragments [144326] (1 family) ![]() |
| Family j.119.1.1: Retinoblastoma-associated protein RB1 fragments [144327] (1 protein) |
| Protein Retinoblastoma-associated protein RB1 fragments [144328] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [144329] (1 PDB entry) Uniprot P06400 829-872 |
| Domain d2azec1: 2aze C:829-872 [127607] Other proteins in same PDB: d2azea1, d2azea2, d2azeb1 near C-terminal fragment bound to the E2F1-DP1 heterodimer |
PDB Entry: 2aze (more details), 2.55 Å
SCOPe Domain Sequences for d2azec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azec1 j.119.1.1 (C:829-872) Retinoblastoma-associated protein RB1 fragments {Human (Homo sapiens) [TaxId: 9606]}
srilvsigesfgtsekfqkinqmvcnsdrvlkrsaegsnppkpl
Timeline for d2azec1: