![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.63: E2F-DP heterodimerization region [144073] (1 superfamily) heterodimeric fold with the N-terminal long helices of both chains forming a parallel coiled coil and their C-terminal folded beta-hairpins interlocking together in a beta-sandwich |
![]() | Superfamily e.63.1: E2F-DP heterodimerization region [144074] (3 families) ![]() |
![]() | Family e.63.1.1: DP dimerization segment [144075] (1 protein) Pfam PF08781 |
![]() | Protein Transcription factor DP-1 [144076] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144077] (1 PDB entry) Uniprot Q14186 199-346 |
![]() | Domain d2azea1: 2aze A:199-346 [127605] Other proteins in same PDB: d2azea2, d2azeb1, d2azec1 |
PDB Entry: 2aze (more details), 2.55 Å
SCOPe Domain Sequences for d2azea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azea1 e.63.1.1 (A:199-346) Transcription factor DP-1 {Human (Homo sapiens) [TaxId: 9606]} aqecqnleverqrrlerikqkqsqlqelilqqiafknlvqrnrhaeqqasrppppnsvih lpfiivntskktvidcsisndkfeylfnfdntfeihddievlkrmgmacglesgscsaed lkmarslvpkalepyvtemaqgtvggvf
Timeline for d2azea1: