SCOPe 2.08: Domain d2azea1: 2aze A:199-346

Lineage for d2azea1 (2aze A:199-346)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.63: E2F-DP heterodimerization region [144073] (1 superfamily)
   heterodimeric fold with the N-terminal long helices of both chains forming a parallel coiled coil and their C-terminal folded beta-hairpins interlocking together in a beta-sandwich

4. Superfamily e.63.1: E2F-DP heterodimerization region [144074] (3 families)

5. Family e.63.1.1: DP dimerization segment [144075] (1 protein)
   Pfam PF08781

6. Protein Transcription factor DP-1 [144076] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144077] (1 PDB entry)
   Uniprot Q14186 199-346

8. Domain d2azea1: 2aze A:199-346 [127605]
   Other proteins in same PDB: d2azea2, d2azeb1, d2azec1

Details for d2azea1

PDB Entry: 2aze, 2.55 Å

PDB Description: Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer

PDB Compounds: (A:) Transcription factor Dp-1

SCOPe Domain Sequences for d2azea1:

Sequence; same for both SEQRES and ATOM records:

>d2azea1 e.63.1.1 (A:199-346) Transcription factor DP-1 {Human (Homo sapiens) [TaxId: 9606]}
aqecqnleverqrrlerikqkqsqlqelilqqiafknlvqrnrhaeqqasrppppnsvih
lpfiivntskktvidcsisndkfeylfnfdntfeihddievlkrmgmacglesgscsaed
lkmarslvpkalepyvtemaqgtvggvf

Timeline for d2azea1:

• d2azea1 first appeared in SCOP 1.73
  
• d2azea1 appears in SCOPe 2.07