![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.63: E2F-DP heterodimerization region [144073] (1 superfamily) heterodimeric fold with the N-terminal long helices of both chains forming a parallel coiled coil and their C-terminal folded beta-hairpins interlocking together in a beta-sandwich |
![]() | Superfamily e.63.1: E2F-DP heterodimerization region [144074] (3 families) ![]() |
![]() | Family e.63.1.2: E2F dimerization segment [144078] (1 protein) PfamB PB001971 |
![]() | Protein Transcription factor E2F1 [144079] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144080] (1 PDB entry) Uniprot Q01094 201-301 |
![]() | Domain d2azeb1: 2aze B:201-301 [127606] Other proteins in same PDB: d2azea1, d2azea2, d2azec1 |
PDB Entry: 2aze (more details), 2.55 Å
SCOPe Domain Sequences for d2azeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azeb1 e.63.1.2 (B:201-301) Transcription factor E2F1 {Human (Homo sapiens) [TaxId: 9606]} grlegltqdlrqlqeseqqldhlmnicttqlrllsedtdsqrlayvtcqdlrsiadpaeq mvmvikappetqlqavdssenfqislkskqgpidvflcpee
Timeline for d2azeb1: